PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000950.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NF-YB
Protein Properties Length: 183aa    MW: 19785 Da    PI: 6.1064
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000950.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB105.43.8e-3329117694
                    NF-YB   6 rflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                              + +P++ v +im++++P  a+i+++aketvq+cv+efi +vt++a++++++e+rkt++++dl+wa+  lG+  y+e+l+ +++ yr
  Itr_sc000950.1_g00001.1  29 NDIPLSTVLKIMREAIPRSARIADEAKETVQKCVTEFIHYVTAKANERAKQERRKTVTTEDLIWAMRALGLGSYAEELTDFITDYR 114
                              569*********************************************************************************** PP

                    NF-YB  92 ele 94 
                               ++
  Itr_sc000950.1_g00001.1 115 ATH 117
                              875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.109.6E-3430119IPR009072Histone-fold
SuperFamilySSF471131.03E-2731124IPR009072Histone-fold
PfamPF008084.2E-223194IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.7E-75876No hitNo description
PRINTSPR006153.7E-77795No hitNo description
PRINTSPR006153.7E-796114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MNADDNTNAN MNADNAAAAG PQRRSTAQND IPLSTVLKIM REAIPRSARI ADEAKETVQK  60
CVTEFIHYVT AKANERAKQE RRKTVTTEDL IWAMRALGLG SYAEELTDFI TDYRATHVHG  120
RAASHPLPPP PVQQVPFMQG FPVPGFVPGP VNDGAGGSAS SSSPSFGGDY FFDTSYPPTN  180
FNG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B3e-2531114891Transcription factor HapC (Eurofung)
4g92_B3e-2531114891Transcription factor HapC (Eurofung)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14746510
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.13e-30NF-YB family protein